Structure of PDB 8i9p Chain CI Binding Site BS02

Receptor Information
>8i9p Chain CI (length=146) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQPGVMYIARLPHGFYEHELRGYFSQFGEITRLRVVRNKKTGASRHRAFI
EFADAEVADIAARTMDKYLLFGHILTCKIVPPAQVHPDLFKGANRRFKVV
PWNKMAGRQLERPLSESQWQVKVAKEEQRRAARAEKLKEMGYEFEA
Ligand information
>8i9p Chain LX (length=22) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SKAAKGAQAKKAAQAALKGVHS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i9p Mechanism of 5S RNP recruitment and helicase-surveilled rRNA maturation during pre-60S biogenesis.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		F210 V240 I243
Binding residue
(residue number reindexed from 1)		F27 V57 I60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
Cellular Component
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8i9p, PDBe:8i9p, PDBj:8i9p
PDBsum8i9p
PubMed37129998
UniProtG0S1H0

[Back to BioLiP]