Structure of PDB 4v9r Chain CI Binding Site BS02

Receptor Information
>4v9r Chain CI (length=127) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLR
AVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGF
LTRDARVVERKKYGKHKARRAPQYSKR
Ligand information
>4v9r Chain CX (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcgggguggagcagccugguagcucgucgggcucauaacccgaaggucgu
cgguucaaauccggcccccgcaacca
<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v9r The antibiotics dityromycin and GE82832 bind protein S12 and block EF-G-catalyzed translocation.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		K127 R128
Binding residue
(residue number reindexed from 1)		K126 R127
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9r, PDBe:4v9r, PDBj:4v9r
PDBsum4v9r
PubMed24412368
UniProtP80374|RS9_THET8 Small ribosomal subunit protein uS9 (Gene Name=rpsI)

[Back to BioLiP]