Structure of PDB 4v6w Chain CG Binding Site BS02

Receptor Information
>4v6w Chain CG (length=241) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVVNQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIRVQRQKAVLQKRLK
VPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAKKLRLKKIAEAKAKGK
DVEPKKKPSYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPALCR
KMGVPYCIVKGKARLGRLVRRKTCTTLALTTVDNNDKANFGKVLEAVKTN
FNERHEEIRRHWGGGILGSKSLARISKLERAKARELAQKQG
Ligand information
>4v6w Chain A9 (length=30) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugcuuggacuacauaugguugaggguugua
..............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v6w Structures of the human and Drosophila 80S ribosome.
Resolution6.0 Å
Binding residue
(original residue number in PDB)		W62 Y65 I66 Q69 R70 K94 H164 K190
Binding residue
(residue number reindexed from 1)		W32 Y35 I36 Q39 R40 K64 H134 K160
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000470 maturation of LSU-rRNA
GO:0002181 cytoplasmic translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6w, PDBe:4v6w, PDBj:4v6w
PDBsum4v6w
PubMed23636399
UniProtP46223|RL7A_DROME Large ribosomal subunit protein eL8 (Gene Name=RpL7A)

[Back to BioLiP]