Structure of PDB 6zmo Chain CE Binding Site BS02

Receptor Information
>6zmo Chain CE (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KFNWKGTIKAILKQAPDNEITIKKLRKKVLAQYYTVTDEHHRSEEELLVI
FNKKISKNPTFKLLKDKVKLVK
Ligand information
>6zmo Chain CB (length=87) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucaggauggccgaguggucuaaggcgccagacucaaguucuggucuccg
gauggaggcguggguucgaaucccacuucugacacca
<<<<<<...<<<...........>>><<<<<<.......>>>>>><<<<.
...>>>>..<<<<<.......>>>>>.>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zmo Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		N310 K312 K316 K320
Binding residue
(residue number reindexed from 1)		N3 K5 K9 K13
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0140297 DNA-binding transcription factor binding
GO:0140416 transcription regulator inhibitor activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006364 rRNA processing
GO:0045087 innate immune response
GO:0045824 negative regulation of innate immune response
GO:0045943 positive regulation of transcription by RNA polymerase I
GO:0048821 erythrocyte development
GO:0050766 positive regulation of phagocytosis
Cellular Component
GO:0001750 photoreceptor outer segment
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0042995 cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zmo, PDBe:6zmo, PDBj:6zmo
PDBsum6zmo
PubMed32680882
UniProtQ9NX58|LYAR_HUMAN Cell growth-regulating nucleolar protein (Gene Name=LYAR)

[Back to BioLiP]