Structure of PDB 8jiv Chain CD Binding Site BS02

Receptor Information
>8jiv Chain CD (length=271) Species: 4565 (Triticum aestivum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTN
KDVTAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLAR
RVLKCRDLDQEYEGNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNR
VFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEIHRKYIYGGHVADYM
KSLADEEPEKYQSHFSEYIKKGIEADNMEALYKKVHAAIRADPTHKRYNP
KKLTYEQRKASLVERLNALNS
Ligand information
>8jiv Chain Ab (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggaugcgaucauaccagcacuaaggcaucggaucccgucagaacuccgaa
guuaagcgugcuugggcgagaguaguacaaggaugggugaccucuuggga
aguccucguguugcauucc
<<<<<<<<<....<<<<<<<......<<<<<..............>>>..
>>.....>>>>>.>><<<<<.<.....<.<<<<.<<....>>>>>>.>..
..>.>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jiv Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.
Resolution2.84 Å
Binding residue
(original residue number in PDB)		K9 R11 S14 K15 V19 F21 R23 T29 Y31 R34 R51 R55 T57 N58 K59 Q64 I70 A71 G72 D73 V75 N95 Y96 R152 T154 T155 N157 R158 Y198 H203 V204 Y207 H222 F223 S224 E225 Y226 H263 Y266 N267 P268 K269 K270 L271 Y273 L280 R283
Binding residue
(residue number reindexed from 1)		K1 R3 S6 K7 V11 F13 R15 T21 Y23 R26 R43 R47 T49 N50 K51 Q56 I62 A63 G64 D65 V67 N87 Y88 R144 T146 T147 N149 R150 Y190 H195 V196 Y199 H214 F215 S216 E217 Y218 H245 Y248 N249 P250 K251 K252 L253 Y255 L262 R265
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jiv, PDBe:8jiv, PDBj:8jiv
PDBsum8jiv
PubMed38458197
UniProtA0A3B6DD91

[Back to BioLiP]