Structure of PDB 8p6j Chain CCC Binding Site BS02

Receptor Information
>8p6j Chain CCC (length=106) Species: 301448 (Streptococcus pyogenes serotype M3) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDARSVNGEFPRHVKLKNEIENLLDQVTQLYTKHNSNYQQYNAQAGRLDL
RQKAEYLKGLNDWAERLLQELNGEDVKKVLGKVAFEKDDLEKEVKELKEK
IDKKEK
Ligand information
>8p6j Chain JJJ (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GPPGPPGPPGVPGEAGPPGPPGPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8p6j Structural basis for collagen recognition by the Streptococcus pyogenes M3 protein
Resolution2.324 Å
Binding residue
(original residue number in PDB)		N24 Q31 K35
Binding residue
(residue number reindexed from 1)		N22 Q29 K33
Enzymatic activity
Enzyme Commision number ?
External links