Structure of PDB 6tvw Chain CCC Binding Site BS02

Receptor Information
>6tvw Chain CCC (length=38) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
Ligand information
>6tvw Chain DbD (length=13) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NNYTSLIHSLIEE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tvw Systematic Evaluation of Fluorination as Modification for Peptide-Based Fusion Inhibitors against HIV-1 Infection.
Resolution1.45 Å
Binding residue
(original residue number in PDB)		Q563 Q567
Binding residue
(residue number reindexed from 1)		Q11 Q15
Enzymatic activity
Enzyme Commision number ?
External links