Structure of PDB 8rcm Chain C2 Binding Site BS02

Receptor Information

>8rcm Chain C2 (length=212) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKAS
VSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQI
NIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKV
EVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVW
IFKGEILGGMAA

Ligand information

>8rcm Chain V2 (length=58) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaggacggugagcuucgugacaauuaaaaaaaagguuucgcgcugggcca
aaaucgaa

..................................................
........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8rcm Transient disome complex formation in native polysomes during ongoing protein synthesis captured by cryo-EM.
Resolution	3.59 Å
Binding residue (original residue number in PDB)	M129 R131 R132 R164
Binding residue (residue number reindexed from 1)	M128 R130 R131 R163

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rcm, PDBe:8rcm, PDBj:8rcm
PDBsum	8rcm
PubMed	38409277
UniProt	P0A7V3\|RS3_ECOLI Small ribosomal subunit protein uS3 (Gene Name=rpsC)

[Back to BioLiP]