Structure of PDB 7spb Chain C11 Binding Site BS02

Receptor Information
>7spb Chain C11 (length=217) Species: 90370 (Salmonella enterica subsp. enterica serovar Typhi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSPATISLPQGGQFRLSISNTDPNMIFIPGDKVTAITAPGGMLADKRLTR
AGGVLFTSVATRTFTIFVETARGQTFSVVATPVKGEGRVYRLMSAEPPSR
PETRKWETAQAYEKLLISLNRAVLTGDIPDGYGEVKPLSDGIRLPGGFSV
TPLKAWAGDQLRADRYELRNANTWGVALREQDFWKPGVRAVMFDNNAQTL
MGGGRMTVTVIRGNGEG
Ligand information
>7spb Chain F10 (length=11) Species: 90370 (Salmonella enterica subsp. enterica serovar Typhi) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RPGMMDSQEFS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7spb Structure of a type IV secretion system core complex encoded by multi-drug resistance F plasmids
Resolution3.31 Å
Binding residue
(original residue number in PDB)
P47 A68 T81
Binding residue
(residue number reindexed from 1)
P23 A44 T57
Enzymatic activity
Enzyme Commision number ?
External links