Structure of PDB 9c3u Chain C Binding Site BS02

Receptor Information
>9c3u Chain C (length=238) Species: 95486 (Burkholderia cenocepacia) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGIELHNRDFLTDAAHLPDASIDLIVADPPYGLNDSDKRSGDDFLAWTRE
WLELAIPLKPSGSMYIFCTWQYAPEIFSKTQLTMVNEIIWDRRVPSMGGT
TRRFTSVHDNIGFFAVSRAYYFDLDPVRIPYDADTKKARSRKLFEGSKWL
EMGYNPKDVWSVSRLHRQHAERVDHPTQKPLEIIERMVLASCPPGGRVLD
PFMGSGTTAACARQGRDFVGYEINESYCAIAHERVNAL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9c3u Burkholderia cenocepacia epigenetic regulator M.BceJIV simultaneously engages two DNA recognition sequences for methylation.
Resolution2.77 Å
Binding residue
(original residue number in PDB)		V133 M136 G137 G138 S202 H205 Q207 H208
Binding residue
(residue number reindexed from 1)		V94 M97 G98 G99 S163 H166 Q168 H169
External links