Structure of PDB 9c3s Chain C Binding Site BS02

Receptor Information
>9c3s Chain C (length=244) Species: 95486 (Burkholderia cenocepacia) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LHNRDFLTDAAHLPDASIDLIVADPPYGLGKDYGNDSDKRSGDDFLAWTR
EWLELAIPKLKPSGSMYIFCTWQYAPEIFSFLKTQLTMVNEIIWDRRVPS
MGGTTRRFTSVHDNIGFFAVSRAYYFDLDPVRIPYDADTKKARSRKLFEG
SKWLEMGYNPKDVWSVSRLHRQHAERVDHPTQKPLEIIERMVLASCPPGG
RVLDPFMGSGTTAVACARQGRDFVGYEINESYCAIAHERVNALA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9c3s Burkholderia cenocepacia epigenetic regulator M.BceJIV simultaneously engages two DNA recognition sequences for methylation.
Resolution2.16 Å
Binding residue
(original residue number in PDB)		R132 V133 P134 M136 G137 G138 T139 T144 S202 H205 Q207 H208 A209
Binding residue
(residue number reindexed from 1)		R97 V98 P99 M101 G102 G103 T104 T109 S167 H170 Q172 H173 A174
External links