Structure of PDB 8yzt Chain C Binding Site BS02

Receptor Information
>8yzt Chain C (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ITLNSEEDYPNGTWLGDENNPEMRVRCAIIPSDMLHISTNCRTAEKMALT
LLDYLFHREVQAVSNLSGQGKHGKKQLDPLTIYGIRCHLFYKFGITESDW
YRIKQSIDSKCRTAWRRKQRG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yzt Structural basis of DNA recognition by BEN domain proteins reveals a role for oligomerization in unmethylated DNA selection by BANP.
Resolution2.58 Å
Binding residue
(original residue number in PDB)		N269 S271 Q273 G274 H276 K278 Y305 R316 W319 R320
Binding residue
(residue number reindexed from 1)		N65 S67 Q69 G70 H72 K74 Y101 R112 W115 R116
External links
PDB RCSB:8yzt, PDBe:8yzt, PDBj:8yzt
PDBsum8yzt
PubMed39225042
UniProtQ8N9N5|BANP_HUMAN Protein BANP (Gene Name=BANP)

[Back to BioLiP]