Structure of PDB 8yhd Chain C Binding Site BS02

Receptor Information
>8yhd Chain C (length=199) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTMKKIYVTMKTLSPLYTGEVRREDKEAAQKRVNFPVRKTATNKVLIPF
KGALRSALEIMLKAKGENVCDTGESRARPCGRCVTCSLFGSMGRAGRASV
DFLISNDTKEQIVRESTHLRIERQTKSASDTFKGEEVIEGATFTATITIS
NPQEKDLSLIQSALKFIEENGIGGWLNKGYGRVSFEVKSEDVATDRFLK
Ligand information
>8yhd Chain N (length=35) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaagcgcaccuaauuucgaauccagcaugagaagc
...................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yhd Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution2.93 Å
Binding residue
(original residue number in PDB)		N36 F37 R77 M93 D131 F133
Binding residue
(residue number reindexed from 1)		N35 F36 R76 M92 D130 F132
External links