Structure of PDB 8ugq Chain C Binding Site BS02

Receptor Information
>8ugq Chain C (length=213) Species: 10823 (Maize streak virus - [Nigeria]) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGSKADRPSLQIQTLQHAGTTMITVPSGGVCDLINTYARGSDEGNRHTSE
TLTYKIAIDYHFVADAAACRYSNTGTGVMWLVYDTTPGGQAPTPQTIFAY
PDTLKAWPATWKVSRELCHRFVVKRRWLFNMETDGRIGSDIPPSNASWKP
CKRNIYFHKFTSGLGVRTQWKNVTDGGVGAIQRGALYMVIAPGNGLTFTA
HGQTRLYFKSVGN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ugq The two states of Maize Streak Virus (MSV) Geminivirus Architecture
Resolution3.17 Å
Binding residue
(original residue number in PDB)		S39 I42 K85 F190 R235 Y237
Binding residue
(residue number reindexed from 1)		S9 I12 K55 F160 R205 Y207
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005198 structural molecule activity
Biological Process
GO:0046718 symbiont entry into host cell
GO:0075732 viral penetration into host nucleus
Cellular Component
GO:0019028 viral capsid
GO:0039615 T=1 icosahedral viral capsid
GO:0042025 host cell nucleus
GO:0043657 host cell

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ugq, PDBe:8ugq, PDBj:8ugq
PDBsum8ugq
PubMed
UniProtP06448|CAPSD_MSVN Capsid protein (Gene Name=V1)

[Back to BioLiP]