Structure of PDB 8u77 Chain C Binding Site BS02

Receptor Information
>8u77 Chain C (length=71) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVKGSVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFI
IDLYSLPEGLLKSLWDYVKKN
Ligand information
>8u77 Chain D (length=12) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EPKLLLKINLKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8u77 Molecular insight into interactions between the Taf14, Yng1 and Sas3 subunits of the NuA3 complex.
Resolution1.93 Å
Binding residue
(original residue number in PDB)		L186 E191 V195 V198 E216 G218 E219 F220 I221 I222 D223 Y225
Binding residue
(residue number reindexed from 1)		L15 E20 V24 V27 E45 G47 E48 F49 I50 I51 D52 Y54
External links
PDB RCSB:8u77, PDBe:8u77, PDBj:8u77
PDBsum8u77
PubMed38914563
UniProtP35189|TAF14_YEAST Transcription initiation factor TFIID subunit 14 (Gene Name=TAF14)

[Back to BioLiP]