Structure of PDB 8tiz Chain C Binding Site BS02

Receptor Information
>8tiz Chain C (length=210) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSDGICEIHVAKYAEIF
GLTSAEASKDIRQALKSFAGKEVVFYYESFPWFIKPAHSPSRGLYSVHIN
PYLIPFFIGRFTQFRLSETKEITNPYAMRLYESLCQYRKPDGSGIVSLKI
DWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPMRLSYIEKKKGRQT
THIVFSFRDI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tiz Towards automated crystallographic structure refinement with phenix.refine.
Resolution3.11 Å
Binding residue
(original residue number in PDB)
S75 S79 K80 R83 R124 G125 Y127 P195 Q196 S197 Y198 D203 R207 R233
Binding residue
(residue number reindexed from 1)
S54 S58 K59 R62 R92 G93 Y95 P160 Q161 S162 Y163 D168 R172 R198
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003887 DNA-directed DNA polymerase activity
Biological Process
GO:0006260 DNA replication
GO:0006270 DNA replication initiation
GO:0006276 plasmid maintenance
GO:0071897 DNA biosynthetic process

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:8tiz, PDBe:8tiz, PDBj:8tiz
PDBsum8tiz
PubMed
UniProtP03856|REPE1_ECOLI Replication initiation protein (Gene Name=repE)

[Back to BioLiP]