Structure of PDB 8sro Chain C Binding Site BS02

Receptor Information
>8sro Chain C (length=86) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NMDYFKYHNMRPPFTYATLIRWAILEAPERQRTLNEIYHWFTRMFAYFRN
HPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDEFE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8sro FoxP3 tetramer on TTTG repeats
Resolution3.3 Å
Binding residue
(original residue number in PDB)		L360 R386 H387 S390 R397 W406
Binding residue
(residue number reindexed from 1)		L34 R60 H61 S64 R71 W80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8sro, PDBe:8sro, PDBj:8sro
PDBsum8sro
PubMed38030726
UniProtQ99JB6|FOXP3_MOUSE Forkhead box protein P3 (Gene Name=Foxp3)

[Back to BioLiP]