Structure of PDB 8rtt Chain C Binding Site BS02

Receptor Information
>8rtt Chain C (length=370) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG
DEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL
TEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDS
GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE
REIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERF
RCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTM
YPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
WISKQEYDESGPSIVHRKCF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rtt Mechanism of formin-mediated processive elongation of actin filaments revealed by cryo-EM
Resolution3.56 Å
Binding residue
(original residue number in PDB)		I75 P112 R177
Binding residue
(residue number reindexed from 1)		I70 P107 R172
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology
Molecular Function
GO:0005200 structural constituent of cytoskeleton
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0019894 kinesin binding
GO:0019901 protein kinase binding
GO:0030957 Tat protein binding
GO:0031492 nucleosomal DNA binding
GO:0042802 identical protein binding
GO:0048156 tau protein binding
GO:0050998 nitric-oxide synthase binding
GO:0098973 structural constituent of postsynaptic actin cytoskeleton
Biological Process
GO:0000079 regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0001738 morphogenesis of a polarized epithelium
GO:0006338 chromatin remodeling
GO:0006357 regulation of transcription by RNA polymerase II
GO:0007010 cytoskeleton organization
GO:0007163 establishment or maintenance of cell polarity
GO:0007409 axonogenesis
GO:0008284 positive regulation of cell population proliferation
GO:0021762 substantia nigra development
GO:0022898 regulation of transmembrane transporter activity
GO:0030071 regulation of mitotic metaphase/anaphase transition
GO:0032091 negative regulation of protein binding
GO:0034333 adherens junction assembly
GO:0035633 maintenance of blood-brain barrier
GO:0042981 regulation of apoptotic process
GO:0045176 apical protein localization
GO:0045582 positive regulation of T cell differentiation
GO:0045596 negative regulation of cell differentiation
GO:0045597 positive regulation of cell differentiation
GO:0045663 positive regulation of myoblast differentiation
GO:0045893 positive regulation of DNA-templated transcription
GO:0048870 cell motility
GO:0051621 regulation of norepinephrine uptake
GO:0051623 positive regulation of norepinephrine uptake
GO:0051726 regulation of cell cycle
GO:0070316 regulation of G0 to G1 transition
GO:0070527 platelet aggregation
GO:0071896 protein localization to adherens junction
GO:0072749 cellular response to cytochalasin B
GO:0098974 postsynaptic actin cytoskeleton organization
GO:0150111 regulation of transepithelial transport
GO:1900242 regulation of synaptic vesicle endocytosis
GO:1902459 positive regulation of stem cell population maintenance
GO:1903076 regulation of protein localization to plasma membrane
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:2000045 regulation of G1/S transition of mitotic cell cycle
GO:2000779 regulation of double-strand break repair
GO:2000781 positive regulation of double-strand break repair
GO:2000819 regulation of nucleotide-excision repair
Cellular Component
GO:0000776 kinetochore
GO:0000785 chromatin
GO:0000786 nucleosome
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005884 actin filament
GO:0005886 plasma membrane
GO:0005903 brush border
GO:0005911 cell-cell junction
GO:0005912 adherens junction
GO:0005925 focal adhesion
GO:0015629 actin cytoskeleton
GO:0016020 membrane
GO:0016363 nuclear matrix
GO:0016514 SWI/SNF complex
GO:0016586 RSC-type complex
GO:0030027 lamellipodium
GO:0030424 axon
GO:0030863 cortical cytoskeleton
GO:0031982 vesicle
GO:0032991 protein-containing complex
GO:0035060 brahma complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:0036464 cytoplasmic ribonucleoprotein granule
GO:0043296 apical junction complex
GO:0044305 calyx of Held
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:0070160 tight junction
GO:0071564 npBAF complex
GO:0071565 nBAF complex
GO:0072562 blood microparticle
GO:0097433 dense body
GO:0098685 Schaffer collateral - CA1 synapse
GO:0098793 presynapse
GO:0098871 postsynaptic actin cytoskeleton
GO:0098978 glutamatergic synapse
GO:0140092 bBAF complex
GO:0140288 GBAF complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rtt, PDBe:8rtt, PDBj:8rtt
PDBsum8rtt
PubMed38603491
UniProtP60709|ACTB_HUMAN Actin, cytoplasmic 1 (Gene Name=ACTB)

[Back to BioLiP]