Structure of PDB 8r3k Chain C Binding Site BS02

Receptor Information
>8r3k Chain C (length=249) Species: 1318616 (Influenza A virus (A/Zhejiang/DTID-ZJU01/2013(H7N9))) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM
MAMKYPITADKRIMEMIPERNEQRQTLWSKTNDAGSDRVMVSPLAVTWWN
RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDINPG
HADLSAKEAQDVIMEVVFPNEVGARILTSESQLTITKEKKKELQDCKIAP
LMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCWEQMYTPGGE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8r3k The host RNA polymerase II C-terminal domain is the anchor for replication of the influenza virus genome.
Resolution3.43 Å
Binding residue
(original residue number in PDB)		K33 P43 Y205
Binding residue
(residue number reindexed from 1)		K33 P43 Y205
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003968 RNA-dependent RNA polymerase activity
Biological Process
GO:0001172 RNA-templated transcription
GO:0006351 DNA-templated transcription
GO:0006370 7-methylguanosine mRNA capping
GO:0019083 viral transcription
GO:0039523 symbiont-mediated suppression of host mRNA transcription via inhibition of RNA polymerase II activity
GO:0039694 viral RNA genome replication
GO:0075526 cap snatching
Cellular Component
GO:0033650 host cell mitochondrion
GO:0042025 host cell nucleus
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8r3k, PDBe:8r3k, PDBj:8r3k
PDBsum8r3k
PubMed38316757
UniProtX5F427

[Back to BioLiP]