Structure of PDB 8pvv Chain C Binding Site BS02

Receptor Information
>8pvv Chain C (length=229) Species: 1344584 (Archaeoglobus fulgidus DSM 8774) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGILYINIYPIVNYPETIKVSAIPYYEEFLPGKWKKRIGDLIYLYGYGIE
NEFDEIDNSNALFGKIFRKYLLDILSENIATPWQLKELGSTLRLVKEITE
NYEFSNIIKLQYELIINVHHWQNTNFGIIVDLKINILDRENNQRISYTKI
KDKYGESVKKKIWVSVQAFHRHLTPEGKKYATAMRDKFNLLTGLLKEAFG
SSEDEKTFSTPDGEIKIVFKPLEIVEVSN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pvv The missing part: the Archaeoglobus fulgidus Argonaute forms a functional heterodimer with an N-L1-L2 domain protein.
Resolution2.81 Å
Binding residue
(original residue number in PDB)		K53 R54 R85 S107 N134 T165 K176 W180 G194 K195 K196
Binding residue
(residue number reindexed from 1)		K36 R37 R68 S90 N117 T148 K159 W163 G177 K178 K179
Enzymatic activity
Enzyme Commision number ?
External links