Structure of PDB 8ok9 Chain C Binding Site BS02

Receptor Information
>8ok9 Chain C (length=236) Species: 224325 (Archaeoglobus fulgidus DSM 4304) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHHSQDPMSGILYINIYPIVNYPETIKVSAIPYYEEFLPGKWKKRIGDLI
YLYGYGIENEFDEIDNSNALFGKIFRKYLLDILSENIATPWQLKELGSTL
RLVKEITENYEFSNIIKLQYELIINVHHWQNTNFGIIVDLKINILDRENN
QRISYTKIKDKYGESVKKKIWVSVQAFHRHLTPEGKKYATAMRDKFNLLT
GLLKEAFGSSEDEKTFSTPDGEIKIVFKPLEIVEVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ok9 The missing part: the Archaeoglobus fulgidus Argonaute forms a functional heterodimer with an N-L1-L2 domain protein.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
K176 K177 W180
Binding residue
(residue number reindexed from 1)
K167 K168 W171
Enzymatic activity
Enzyme Commision number ?
External links