Structure of PDB 8of4 Chain C Binding Site BS02

Receptor Information
>8of4 Chain C (length=120) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAA
VLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIA
QGGVLPNIQSVLLPKKTESA
Ligand information
>8of4 Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcgatgtatatatctgacacgtgcctggagactagggagtaatcccctt
ggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctag
agctgtctacgaccaattgagcggcctcggcaccgggattctgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8of4 Binding to nucleosome poises SIRT6 for histone H3 de-acetylation
Resolution2.94 Å
Binding residue
(original residue number in PDB)		K9 R29 R42 V43 G44 A45 K75 T76 R77
Binding residue
(residue number reindexed from 1)		K6 R26 R39 V40 G41 A42 K72 T73 R74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8of4, PDBe:8of4, PDBj:8of4
PDBsum8of4
PubMed38415718
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]