Structure of PDB 8kcb Chain C Binding Site BS02

Receptor Information
>8kcb Chain C (length=89) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGESSKLARYN
KKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS
Ligand information
>8kcb Chain J (length=126) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tatgtgacacgtgcctggagactagggagtaatccccttggcggttaaaa
cgcgggggacagcgcgtacgtgcgtttaagcggtgctagagctgtctacg
accaattgagcggcctcggcaccggg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8kcb Mechanism of heterochromatin remodeling revealed by the DDM1 bound nucleosome structures.
Resolution3.17 Å
Binding residue
(original residue number in PDB)		F62 I74 P107 T108
Binding residue
(residue number reindexed from 1)		F8 I20 P53 T54
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0009536 plastid

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8kcb, PDBe:8kcb, PDBj:8kcb
PDBsum8kcb
PubMed38870940
UniProtQ9FFC0|H2B10_ARATH Histone H2B.10 (Gene Name=At5g22880)

[Back to BioLiP]