Structure of PDB 8jzw Chain C Binding Site BS02

Receptor Information
>8jzw Chain C (length=62) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQ
IVIAFYEERLTW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jzw Cystal structure of HP1 in complex with TRIM66 peptide
Resolution1.8 Å
Binding residue
(original residue number in PDB)		A129 T130 D131 S132 L139
Binding residue
(residue number reindexed from 1)		A17 T18 D19 S20 L27
External links
PDB RCSB:8jzw, PDBe:8jzw, PDBj:8jzw
PDBsum8jzw
PubMed
UniProtQ13185|CBX3_HUMAN Chromobox protein homolog 3 (Gene Name=CBX3)

[Back to BioLiP]