Structure of PDB 8j91 Chain C Binding Site BS02

Receptor Information
>8j91 Chain C (length=91) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSRSSKAGLQFPVGRIARFLKNGKYATRVGAGAPVYLAAVLEYLAAEVLE
LAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGDVTIANG
Ligand information
>8j91 Chain J (length=113) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cacgtgcctggagactagggagtaatccccttggcggttaaaacgcgggg
gacagcgcgtacgtgcgtttaagcggtgctagagctgtctacgaccaatt
gagcggcctcggc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8j91 Molecular and structural basis of the chromatin remodeling activity by Arabidopsis DDM1.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R30 R43 V44 A46 K76 T77
Binding residue
(residue number reindexed from 1)		R15 R28 V29 A31 K61 T62
Gene Ontology
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8j91, PDBe:8j91, PDBj:8j91
PDBsum8j91
PubMed38992002
UniProtQ9LHQ5|H2A2_ARATH Probable histone H2A.2 (Gene Name=At3g20670)

[Back to BioLiP]