Structure of PDB 8igr Chain C Binding Site BS02

Receptor Information
>8igr Chain C (length=74) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRNEALRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKRDWIPKFSMLL
AVLEWGVVDDDMARLARQVAAILT
Ligand information
>8igr Chain T (length=61) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcaatcaattgttatctaaggaaatacttacatatggttcgtgcaaacaa
acgcaacgagg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8igr Structural basis of lambda CII-dependent transcription activation.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		D36 S38 Q39 W43 W47
Binding residue
(residue number reindexed from 1)		D31 S33 Q34 W38 W42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0019042 viral latency

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8igr, PDBe:8igr, PDBj:8igr
PDBsum8igr
PubMed37269829
UniProtP03042|RPC2_LAMBD Transcriptional activator II (Gene Name=cII)

[Back to BioLiP]