Structure of PDB 8hmz Chain C Binding Site BS02

Receptor Information

>8hmz Chain C (length=285) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AAVEVPAGRVLSARELFAARSRSQKLPQRSHGPKDFLPDGSAAQAERLRR
CREELWQLLAEQRVERLGSLVAAEWRPEEGFVELKSPAGKFWQTMGFSEQ
GRQRLHPEEALYLLECGSIHLFHQDLPLSIQEAYQLLLTDHTVTFLQYQV
FSHLKRLGYVVRRFQPSSVPGQASSPAVVLQHISVLQTTHLPDGGARLLE
KSGGLEIIFDVYQADAVATFRKNNPGKPYARMCISGFDEPVPDLCSLKRL
SYQSGDVPLIFALVDHGDISFYSFRDFTLPQDVGH

Ligand information

>8hmz Chain 3 (length=37) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

auucaaagguuguggguucgaaucccaccagagucgg

...........<<<<<.......>>>>>.........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8hmz Structural basis of pre-tRNA intron removal by human tRNA splicing endonuclease.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	Q35 R36 S37 S105 R462 N464
Binding residue (residue number reindexed from 1)	Q28 R29 S30 S98 R221 N223

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005515	protein binding

	Biological Process
GO:0000379	tRNA-type intron splice site recognition and cleavage
GO:0006388	tRNA splicing, via endonucleolytic cleavage and ligation
GO:0006397	mRNA processing
GO:0008033	tRNA processing

	Cellular Component
GO:0000214	tRNA-intron endonuclease complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8hmz, PDBe:8hmz, PDBj:8hmz
PDBsum	8hmz
PubMed	37028420
UniProt	Q7Z6J9\|SEN54_HUMAN tRNA-splicing endonuclease subunit Sen54 (Gene Name=TSEN54)

[Back to BioLiP]