Structure of PDB 8fyb Chain C Binding Site BS02

Receptor Information
>8fyb Chain C (length=309) Species: 906 (Megasphaera) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGPIIAGKSESSELPRVEDRATFIYIEHAKINRVDSAVTVAEAKGVVRIP
AAMIGVLLLGPGTDISHRAVELLGDTGTALVWVGEQGVRYYASGRALARS
TRFLVKQAELVTNERSRLRVARRMYQMRFPTEDVSKLTMQQLRSHEGARV
RRKYRELSKKYNVPWKKRVYNPDDFAGGDPINQALSAAHVALYGLVHSVV
AALGLSPGLGFVHTGHDRSFIYDVADLYKAEITVPIAFAVAAEAEEGQDI
GQLARLRTRDAFVDGKILKRMVKDLQTLLEIPEEGQIEAEPLSLWDDKEK
LVPYGVNYS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fyb Genome expansion by a CRISPR trimmer-integrase.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
I6 K9 R34 R69 E72 L293 Y305 G306 V307 N308 Y309
Binding residue
(residue number reindexed from 1)
I5 K8 R33 R68 E71 L292 Y304 G305 V306 N307 Y308
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 16 05:58:13 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8fyb', asym_id = 'C', bs = 'BS02', title = 'Genome expansion by a CRISPR trimmer-integrase.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8fyb', asym_id='C', bs='BS02', title='Genome expansion by a CRISPR trimmer-integrase.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003676,0004519,0004520,0043571,0046872,0051607', uniprot = '', pdbid = '8fyb', asym_id = 'C'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0004519,0004520,0043571,0046872,0051607', uniprot='', pdbid='8fyb', asym_id='C')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>