Structure of PDB 8f5g Chain C Binding Site BS02

Receptor Information
>8f5g Chain C (length=175) Species: 496866 (Thermoanaerobacter pseudethanolicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TMKKWYVIFTRSGYENKVRDIIENCFKEEVKLLIPKRKIIERVKGQPVEK
IKLLFPGYVFVNAEMSDDLYYKISEVLKRGIFLKEGKRPAFVKEEEMKII
LSLTKNSDLIDLSKGIMEGERVKIIEGPLKGYEGLIKKIDKRKKRAKVIF
SIAGELKSVDLAIEVMENVSEQQRS
Ligand information
>8f5g Chain F (length=26) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcaaucgcugcuucggcacguugcc
<<<<<.<<.<<<<..>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8f5g NusG-RNA complex
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R36 E40 R41 K43 E119 R120 I135 K136 K137 I138 K140 R141 K142 R144
Binding residue
(residue number reindexed from 1)		R37 E41 R42 K44 E120 R121 I136 K137 K138 I139 K141 R142 K143 R145
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006354 DNA-templated transcription elongation
GO:0006355 regulation of DNA-templated transcription
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0140673 transcription elongation-coupled chromatin remodeling

View graph for
Biological Process
External links
PDB RCSB:8f5g, PDBe:8f5g, PDBj:8f5g
PDBsum8f5g
PubMed38959899
UniProtB0KAR9

[Back to BioLiP]