Structure of PDB 8eue Chain C Binding Site BS02

Receptor Information
>8eue Chain C (length=106) Species: 8353 (Xenopus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILE
LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSV
LLPKKT
Ligand information
>8eue Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagatactaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctggattccagctgaacatgccttttgatgga
gcagtttccaaatacacttttggtagtatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8eue Reorientation of INO80 on hexasomes reveals basis for mechanistic versatility.
Resolution3.48 Å
Binding residue
(original residue number in PDB)
R29 R35 R42 V43 A45 K75 T76 R77
Binding residue
(residue number reindexed from 1)
R15 R21 R28 V29 A31 K61 T62 R63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:8eue, PDBe:8eue, PDBj:8eue
PDBsum8eue
PubMed37384669
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]