Structure of PDB 8d86 Chain C Binding Site BS02

Receptor Information

>8d86 Chain C (length=214) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSHDGICEIHVAKYAE
IFGLTSAEASKDIRQALKSFAGKEVVFYYESFPWFIKPAHSPSRGLYSVH
INPYLIPFFIGRFTQFRLSETKEITNPYAMRLYESLCQYRKPDGSGIVSL
KIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPMRLSYIEKKKGR
QTTHIVFSFRDITS

Ligand information

>8d86 Chain B (length=32) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aggccgtctgagggcaatttgtcacaggtccg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8d86 Towards automated crystallographic structure refinement with phenix.refine.
Resolution	3.12 Å
Binding residue (original residue number in PDB)	S75 S79 K80 R83 R124 G125 Y127 S197 Y198 D203 R207 R233
Binding residue (residue number reindexed from 1)	S56 S60 K61 R64 R94 G95 Y97 S164 Y165 D170 R174 R200

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003887	DNA-directed DNA polymerase activity

	Biological Process
GO:0006260	DNA replication
GO:0006270	DNA replication initiation
GO:0006276	plasmid maintenance
GO:0071897	DNA biosynthetic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8d86, PDBe:8d86, PDBj:8d86
PDBsum	8d86
PubMed	37407546
UniProt	P03856\|REPE1_ECOLI Replication initiation protein (Gene Name=repE)

[Back to BioLiP]