Structure of PDB 8bf9 Chain C Binding Site BS02

Receptor Information

>8bf9 Chain C (length=385) Species: 9940 (Ovis aries) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PFCVILPEIQKPERKIQFKEKVLWTAITLFIFLVCCYWMRVILASNRGLM
ALGISPIVTSGLIMQLLAGATPKDRALFNGAQKLFGMTITIGQSIVYVMT
VCLLITIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAF
SPTTVNTGRGMEFEGAIIALFHLLALREAFYRQNLPNLMNLIATIFVFAV
VIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVI
SQMLSPVGGLCHYLSPPESFGSVLEDPVHAVVYIVFMLGSCAFFSKTWIE
VSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGAL
SVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQS

Ligand information

>8bf9 Chain b (length=29) Species: 9940 (Ovis aries) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8bf9 Molecular view of ER membrane remodeling by the Sec61/TRAP translocon.
Resolution	2.69 Å
Binding residue (original residue number in PDB)	R24 I26 E30
Binding residue (residue number reindexed from 1)	R14 I16 E20

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005048	signal sequence binding
GO:0008320	protein transmembrane transporter activity
GO:0043022	ribosome binding

	Biological Process
GO:0006616	SRP-dependent cotranslational protein targeting to membrane, translocation
GO:0015031	protein transport
GO:0031204	post-translational protein targeting to membrane, translocation

	Cellular Component
GO:0005784	Sec61 translocon complex
GO:0005789	endoplasmic reticulum membrane
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8bf9, PDBe:8bf9, PDBj:8bf9
PDBsum	8bf9
PubMed	37983950
UniProt	A0A6P3YN15

[Back to BioLiP]