Structure of PDB 7x8b Chain C Binding Site BS02

Receptor Information
>7x8b Chain C (length=148) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVV
FWLHDSFPKPRRVCKEPPYKVEESGYAGFIMPIEVHFKNKEEPRKVCFTY
DLFLNLEGNPPVNHLNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7x8b Hotspot mutations in the structured ENL YEATS domain link aberrant transcriptional condensates and cancer.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		H56 S58 F59 G77 Y78 A79 G80 F81 D103 L106 N107
Binding residue
(residue number reindexed from 1)		H54 S56 F57 G75 Y76 A77 G78 F79 D101 L104 N105
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:7x8b, PDBe:7x8b, PDBj:7x8b
PDBsum7x8b
PubMed36272410
UniProtQ03111|ENL_HUMAN Protein ENL (Gene Name=MLLT1)

[Back to BioLiP]