Structure of PDB 7wnr Chain C Binding Site BS02

Receptor Information
>7wnr Chain C (length=49) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKTAISLPDETFDRVSRRASELGMSRSEFFTKAAQRYLHELDAQLLTGQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wnr Structural and mutational analysis of MazE6-operator DNA complex provide insights into autoregulation of toxin-antitoxin systems.
ResolutionN/A
Binding residue
(original residue number in PDB)
K5 T6 A7
Binding residue
(residue number reindexed from 1)
K2 T3 A4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:7wnr, PDBe:7wnr, PDBj:7wnr
PDBsum7wnr
PubMed36109664
UniProtP9WJ87|MAZE6_MYCTU Antitoxin MazE6 (Gene Name=mazE6)

[Back to BioLiP]