Structure of PDB 7vru Chain C Binding Site BS02

Receptor Information

>7vru Chain C (length=369) Species: 43263 (Pseudomonas alcaligenes)

WQMVKFGDIAKHISKRVEPSETDLDIYVGLEHLDPDSLKIKRYGVPSDVA
GQKLLVKKGQIIFGKRRAYQRKVAVADWDCICSAHAMVLEPLSDKVIPEF
LPFFMQSDSFMNRAVAISEGSLSPTIKWKTLSSQSFLMPSLTTQATLIKI
LSKISEVESSLESAKLSLQLLSSAFIDELKNWTIVRAGEACSLITKGASP
RWQGFEYAADGSLFVTSENIQHWAVDISSPKYIPDEFSEKNLRRSQLRAG
DVLVNIVGASIGRCALWDGSHEKANINQAVALLRPKPELDSRWLLAQLYS
KRGQEYFGLSAVDNARPNLSLKSLSDFEFYLPPIEIQKKTMDIFELFSSK
VISNKKLTLKAIKSSLVNN

Ligand information

>7vru Chain I (length=25)

ctgttgcaatagtgcgggttttcga

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7vru Molecular insights into DNA recognition and methylation by non-canonical type I restriction-modification systems.
• Resolution: 2.4 Å
• Binding residue (original residue number in PDB): L39 E40 V58 A59 G60 R75 R76 Y78 Q79 K81 S92 H94 K209 R257 N327 A328 R329 N331 S333 L334 K335
• Binding residue (residue number reindexed from 1): L30 E31 V49 A50 G51 R66 R67 Y69 Q70 K72 S83 H85 K196 R244 N314 A315 R316 N318 S320 L321 K322

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 22 11:14:58 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7vru', asym_id = 'C', bs = 'BS02', title = 'Molecular insights into DNA recognition and meth...anonical type I restriction-modification systems.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7vru', asym_id='C', bs='BS02', title='Molecular insights into DNA recognition and meth...anonical type I restriction-modification systems.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003677', uniprot = '', pdbid = '7vru', asym_id = 'C'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677', uniprot='', pdbid='7vru', asym_id='C')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>