Structure of PDB 7v90 Chain C Binding Site BS02

Receptor Information

>7v90 Chain C (length=109) Species: 9606 (Homo sapiens)

ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPK

Ligand information

>7v90 Chain J (length=145)

ctaaccctaaccctaaccctaaccctaaccctaaccctaaccctaaccct
aaccctaaccctaaccctaaccctaaccctaaccctaaccctaaccctaa
ccctaaccctaaccctaaccctaaccctaaccctaaccctaaccc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7v90 Columnar structure of human telomeric chromatin.
• Resolution: 3.5 Å
• Binding residue (original residue number in PDB): R11 R42 T76 R77
• Binding residue (residue number reindexed from 1): R2 R33 T67 R68

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0031492 nucleosomal DNA binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006325 chromatin organization
• GO:0008285 negative regulation of cell population proliferation
• GO:0031507 heterochromatin formation
• GO:0061644 protein localization to CENP-A containing chromatin

Cellular Component

• GO:0000786 nucleosome
• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0043505 CENP-A containing nucleosome
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:7v90, PDBe:7v90, PDBj:7v90
• PDBsum: 7v90
• PubMed: 36104563
• UniProt: P04908|H2A1B_HUMAN Histone H2A type 1-B/E (Gene Name=H2AC4)