Structure of PDB 7uzp Chain C Binding Site BS02

Receptor Information
>7uzp Chain C (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVMTKEEQIFLLHRAQAQCEKRLKEVLQRPAGRPCLPEWDHILCWPLGAP
GEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKF
L
Ligand information
>7uzp Chain D (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YQDLRRRFFKHHLKAEKHTAEI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uzp Altered signaling at the PTH receptor via modified agonist contacts with the extracellular domain provides a path to prolonged agonism in vivo.
Resolution2.29 Å
Binding residue
(original residue number in PDB)		M32 E35 D69 I71 Y92 D93 V113 R118 T119 W120 A121 N122 Y123 F129
Binding residue
(residue number reindexed from 1)		M3 E6 D40 I42 Y63 D64 V84 R89 T90 W91 A92 N93 Y94 F100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uzp, PDBe:7uzp, PDBj:7uzp
PDBsum7uzp
PubMed36409914
UniProtQ03431|PTH1R_HUMAN Parathyroid hormone/parathyroid hormone-related peptide receptor (Gene Name=PTH1R)

[Back to BioLiP]