Structure of PDB 7uv7 Chain C Binding Site BS02

Receptor Information
>7uv7 Chain C (length=212) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSHDGICEIHVAKYAE
IFGLTSAEASKDIRQALKSFAGKEVVFYYESFPWFIKPAHSPSRGLYSVH
INPYLIPFFIGRFTQFRLSETKEITNPYAMRLYESLCQYRKPDGSGIVSL
KIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPMRLSYIEKKKGR
QTTHIVFSFRDI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uv7 Designed crystalline assemblies of protein and DNA enable site-specific installation of a guest protein, DNA, and small molecule.
Resolution3.02 Å
Binding residue
(original residue number in PDB)		S75 S79 R124 G125 Y127 P195 S197 Y198 D203 R207
Binding residue
(residue number reindexed from 1)		S56 S60 R94 G95 Y97 P162 S164 Y165 D170 R174
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003887 DNA-directed DNA polymerase activity
Biological Process
GO:0006260 DNA replication
GO:0006270 DNA replication initiation
GO:0006276 plasmid maintenance
GO:0071897 DNA biosynthetic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7uv7, PDBe:7uv7, PDBj:7uv7
PDBsum7uv7
PubMed37407546
UniProtP03856|REPE1_ECOLI Replication initiation protein (Gene Name=repE)

[Back to BioLiP]