Structure of PDB 7u0i Chain C Binding Site BS02

Receptor Information
>7u0i Chain C (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAE
ILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNI
QAVLLPK
Ligand information
>7u0i Chain J (length=149) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctttattcacaagcttgcacaatccctgctggacaattctgagtgatggc
agctcccacctttccttcttccttcacttagactacatttattcagcatc
tgtattgttggagtaagttccatgttaatactcaccactgaggatatgt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7u0i Structural mechanism of LIN28B nucleosome targeting by OCT4.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R29 R42 V43 G44 A45 K75 T76 R77
Binding residue
(residue number reindexed from 1)		R18 R31 V32 G33 A34 K64 T65 R66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008150 biological_process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7u0i, PDBe:7u0i, PDBj:7u0i
PDBsum7u0i
PubMed37327775
UniProtQ16777|H2A2C_HUMAN Histone H2A type 2-C (Gene Name=H2AC20)

[Back to BioLiP]