Structure of PDB 7tea Chain C Binding Site BS02

Receptor Information
>7tea Chain C (length=76) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIRRNMAVFSMSVVSKLTDLTPRQIRYYETHELIKPERTEGQKRLFSLND
LERLLEIKSLLEKGFNIKEIKQIIYD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tea Molecular dissection of the glutamine synthetase-GlnR nitrogen regulatory circuitry in Gram-positive bacteria.
Resolution2.35 Å
Binding residue
(original residue number in PDB)
T26 R28 Q29 Y32 Y33 T44 G46 K48 N71 I72
Binding residue
(residue number reindexed from 1)
T21 R23 Q24 Y27 Y28 T39 G41 K43 N66 I67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:7tea, PDBe:7tea, PDBj:7tea
PDBsum7tea
PubMed35778410
UniProtQ2FYY7

[Back to BioLiP]