Structure of PDB 7spm Chain C Binding Site BS02

Receptor Information

>7spm Chain C (length=221) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSDEHDGICEIHVAKY
AEIFGLTSAEASKDIRQALKSFAGKEVVFYKGYESFPWFIKPAHSPSRGL
YSVHINPYLIPFFIGLQNRFTQFRLSETKEITNPYAMRLYESLCQYRKPD
GSGIVSLKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPMRLSY
IEKKKGRQTTHIVFSFRDITS

Ligand information

>7spm Chain B (length=22) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ctgagggcaatttgtcacagga

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7spm Towards automated crystallographic structure refinement with phenix.refine.
Resolution	3.28 Å
Binding residue (original residue number in PDB)	S75 K80 R83 R124 Y127 N159 P195 S197 Y198 D203 R207
Binding residue (residue number reindexed from 1)	S58 K63 R66 R98 Y101 N133 P169 S171 Y172 D177 R181

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003887	DNA-directed DNA polymerase activity

	Biological Process
GO:0006260	DNA replication
GO:0006270	DNA replication initiation
GO:0006276	plasmid maintenance
GO:0071897	DNA biosynthetic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7spm, PDBe:7spm, PDBj:7spm
PDBsum	7spm
PubMed
UniProt	P03856\|REPE1_ECOLI Replication initiation protein (Gene Name=repE)

[Back to BioLiP]