Structure of PDB 7soz Chain C Binding Site BS02

Receptor Information

>7soz Chain C (length=224) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RKNSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSDEHDGICEIHVA
KYAEIFGLTSAEASKDIRQALKSFAGKEVVFYRKGYESFPWFIKPAHSPS
RGLYSVHINPYLIPFFIGLQNRFTQFRLSETKEITNPYAMRLYESLCQYR
KPDGSGIVSLKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPMR
LSYIEKKKGRQTTHIVFSFRDITS

Ligand information

>7soz Chain B (length=22) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ctgagggcaatttgtcacagga

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7soz Towards automated crystallographic structure refinement with phenix.refine.
Resolution	3.14 Å
Binding residue (original residue number in PDB)	S75 R83 R124 Y127 N159 S197 D203 R207
Binding residue (residue number reindexed from 1)	S60 R68 R101 Y104 N136 S174 D180 R184

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003887	DNA-directed DNA polymerase activity

	Biological Process
GO:0006260	DNA replication
GO:0006270	DNA replication initiation
GO:0006276	plasmid maintenance
GO:0071897	DNA biosynthetic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7soz, PDBe:7soz, PDBj:7soz
PDBsum	7soz
PubMed	37407546
UniProt	P03856\|REPE1_ECOLI Replication initiation protein (Gene Name=repE)

[Back to BioLiP]