Structure of PDB 7sdp Chain C Binding Site BS02

Receptor Information
>7sdp Chain C (length=225) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRKNSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSDEHDGICEIHV
AKYAEIFGLTSAEASKDIRQALKSFAGKEVVFYRKGYESFPWFIKPAHSP
SRGLYSVHINPYLIPFFIGLQNRFTQFRLSETKEITNPYAMRLYESLCQY
RKPDGSGIVSLKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPM
RLSYIEKKKGRQTTHIVFSFRDITS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sdp Towards automated crystallographic structure refinement with phenix.refine.
Resolution3.01 Å
Binding residue
(original residue number in PDB)		S75 S79 K80 R83 R124 Y127 N159 P195 S197 Y198 D203 R207
Binding residue
(residue number reindexed from 1)		S61 S65 K66 R69 R102 Y105 N137 P173 S175 Y176 D181 R185
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003887 DNA-directed DNA polymerase activity
Biological Process
GO:0006260 DNA replication
GO:0006270 DNA replication initiation
GO:0006276 plasmid maintenance
GO:0071897 DNA biosynthetic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7sdp, PDBe:7sdp, PDBj:7sdp
PDBsum7sdp
PubMed37407546
UniProtP03856|REPE1_ECOLI Replication initiation protein (Gene Name=repE)

[Back to BioLiP]