Structure of PDB 7s6m Chain C Binding Site BS02

Receptor Information

>7s6m Chain C (length=222) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFS
CFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEASKKEKDKDSKLEKA
LKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGM
VFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPK
EFREISYLKKLKVKKQDRIFPP

Ligand information

>7s6m Chain N (length=5) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgacg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7s6m Captured snapshots of PARP1 in the active state reveal the mechanics of PARP1 allostery.
Resolution	3.2 Å
Binding residue (original residue number in PDB)	E263 I266 F267 E338
Binding residue (residue number reindexed from 1)	E126 I129 F130 E201

Enzymatic activity

Enzyme Commision number

2.4.2.-
2.4.2.30: NAD(+) ADP-ribosyltransferase.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0008270	zinc ion binding

View graph for
Molecular Function

External links

PDB	RCSB:7s6m, PDBe:7s6m, PDBj:7s6m
PDBsum	7s6m
PubMed	35793673
UniProt	P09874\|PARP1_HUMAN Poly [ADP-ribose] polymerase 1 (Gene Name=PARP1)

[Back to BioLiP]