Structure of PDB 7rva Chain C Binding Site BS02

Receptor Information
>7rva Chain C (length=221) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRKNSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSHDGICEIHVAK
YAEIFGLTSAEASKDIRQALKSFAGKEVVFYRYESFPWFIKPAHSPSRGL
YSVHINPYLIPFFIGLQNRFTQFRLSETKEITNPYAMRLYESLCQYRKPD
GSGIVSLKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPMRLSY
IEKKKGRQTTHIVFSFRDITS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rva Towards automated crystallographic structure refinement with phenix.refine.
Resolution1.89 Å
Binding residue
(original residue number in PDB)		S75 S79 K80 R83 R124 G125 Y127 N159 Y161 P195 S197 Y198 R200 D203 R207 V211
Binding residue
(residue number reindexed from 1)		S59 S63 K64 R67 R98 G99 Y101 N133 Y135 P169 S171 Y172 R174 D177 R181 V185
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003887 DNA-directed DNA polymerase activity
Biological Process
GO:0006260 DNA replication
GO:0006270 DNA replication initiation
GO:0006276 plasmid maintenance
GO:0071897 DNA biosynthetic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7rva, PDBe:7rva, PDBj:7rva
PDBsum7rva
PubMed
UniProtP03856|REPE1_ECOLI Replication initiation protein (Gene Name=repE)

[Back to BioLiP]