Structure of PDB 7q4n Chain C Binding Site BS02

Receptor Information
>7q4n Chain C (length=63) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRR
AKERKINKKKLQQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7q4n transcription factor CDX2 bound to hydroxymethylated DNA
Resolution3.2 Å
Binding residue
(original residue number in PDB)		Y189 R190 Y210 I213 Q235 R238 R242
Binding residue
(residue number reindexed from 1)		Y1 R2 Y22 I25 Q47 R50 R54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7q4n, PDBe:7q4n, PDBj:7q4n
PDBsum7q4n
PubMed
UniProtQ99626|CDX2_HUMAN Homeobox protein CDX-2 (Gene Name=CDX2)

[Back to BioLiP]