Structure of PDB 7n8n Chain C Binding Site BS02

Receptor Information
>7n8n Chain C (length=197) Species: 1560514 (Melbournevirus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DHVSVGETQIPKASTQHLLRKAGSLSAAGDTEVPIRGFVHMKLHKLVQKS
LLAMQLAKRKTIMKSDVKKAAELMHLPVFAIPTKDSGAKGSVFLSCRQKG
AGSAGTGSETNSQEVRSQMKSTCLIIPKERFRTMAKEISKKEGHDVHIAE
AALDMLQVIVESCTVRLLEKALVITYSGKRTRVTSKDIETAFMLEHG
Ligand information
>7n8n Chain J (length=125) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atctgacacgtgcctggagactagggagtaatccccttggcggttaaaac
gcgggggacagcgcgtacgtgcgtttaagcggtgctagagctgtctacga
ccaattgagcggcctcggcaccgga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7n8n Virus-encoded histone doublets are essential and form nucleosome-like structures.
Resolution3.89 Å
Binding residue
(original residue number in PDB)		A36 K81 F116 L117 R155 K159 H170 I171 E173 R203 R205
Binding residue
(residue number reindexed from 1)		A13 K58 F93 L94 R132 K136 H147 I148 E150 R180 R182
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0030261 chromosome condensation
Cellular Component
GO:0000786 nucleosome
GO:0030430 host cell cytoplasm
GO:0042025 host cell nucleus
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7n8n, PDBe:7n8n, PDBj:7n8n
PDBsum7n8n
PubMed34297924
UniProtA0A097I2D0|H4H3_MELV Histone doublet H4-H3 (Gene Name=MEL_368)

[Back to BioLiP]