Structure of PDB 7n43 Chain C Binding Site BS02

Receptor Information

>7n43 Chain C (length=205) Species: 6523 (Lymnaea stagnalis)

LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDV
VFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTP
QLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREI
SVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLN
FRKKG

Ligand information

>7n43 Chain H (length=17) Species: 89429 (Conus omaria)

GCCSHPACNVNNPHICG

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7n43 Unique Pharmacological Properties of alpha-Conotoxin OmIA at alpha 7 nAChRs.
• Resolution: 2.47 Å
• Binding residue (original residue number in PDB): Y89 W143 H146 Y185 C187 C188 Y192
• Binding residue (residue number reindexed from 1): Y89 W143 H146 Y185 C187 C188 Y192

Gene Ontology

Molecular Function

• GO:0004888 transmembrane signaling receptor activity
• GO:0005216 monoatomic ion channel activity
• GO:0005230 extracellular ligand-gated monoatomic ion channel activity
• GO:0005231 excitatory extracellular ligand-gated monoatomic ion channel activity
• GO:1904315 transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential

Biological Process

• GO:0006811 monoatomic ion transport
• GO:0007165 signal transduction
• GO:0007268 chemical synaptic transmission
• GO:0034220 monoatomic ion transmembrane transport
• GO:0042391 regulation of membrane potential
• GO:0050877 nervous system process
• GO:0060078 regulation of postsynaptic membrane potential
• GO:0060079 excitatory postsynaptic potential

Cellular Component

• GO:0005576 extracellular region
• GO:0016020 membrane
• GO:0043005 neuron projection
• GO:0043083 synaptic cleft
• GO:0045202 synapse
• GO:0098794 postsynapse

External links

• PDB: RCSB:7n43, PDBe:7n43, PDBj:7n43
• PDBsum: 7n43
• PubMed: 34955864
• UniProt: P58154|ACHP_LYMST Acetylcholine-binding protein