Structure of PDB 7mp3 Chain C Binding Site BS02

Receptor Information
>7mp3 Chain C (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRQGFVLSLCHLQK
VKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHC
CT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7mp3 Enhancing the Bioactivity of Bicyclic Peptides Targeted to Grb7-SH2 by Restoring Cell Permeability.
Resolution2.55 Å
Binding residue
(original residue number in PDB)
R438 K478 H479 Y480 L481 M495 D496 Q499
Binding residue
(residue number reindexed from 1)
R14 K52 H53 Y54 L55 M69 D70 Q73
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7mp3, PDBe:7mp3, PDBj:7mp3
PDBsum7mp3
PubMed35625882
UniProtQ14451|GRB7_HUMAN Growth factor receptor-bound protein 7 (Gene Name=GRB7)

[Back to BioLiP]