Structure of PDB 7m5b Chain C Binding Site BS02

Receptor Information
>7m5b Chain C (length=160) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SASEEQVAQDTEEVFRSYVFYRHQQEQEAPADPEMVTLPLQPSSTMGQVG
RQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINW
GRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHSIARWIAQRG
GWVAALNLCN
Ligand information
>7m5b Chain D (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DIIRNIARHLAQMGDSMDRSWGGC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7m5b Structural basis of BAK activation in mitochondrial apoptosis initiation.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		I81 I85 Y89 E92 F93 M96 I114 S117 L118 N124 W125 G126 R127 V129 A130 F134 N182 L183 C184 N185
Binding residue
(residue number reindexed from 1)		I56 I60 Y64 E67 F68 M71 I89 S92 L93 N99 W100 G101 R102 V104 A105 F109 N157 L158 C159 N160
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:7m5b, PDBe:7m5b, PDBj:7m5b
PDBsum7m5b
PubMed35017502
UniProtQ16611|BAK_HUMAN Bcl-2 homologous antagonist/killer (Gene Name=BAK1)

[Back to BioLiP]